DPCfam | MC47341
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 401 |
|---|---|
| Mean domain length (aa) | 913 ± 126 aa |
| Residues in low-complexity regions (%) | 4.74 |
| Residues in coiled-coil regions (%) | 0.01 |
| Predicted disordered residues (%) | 24.0 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF16910 |
| Sequences matching dominant architecture (%) | 33.44 |
| Average overlap percent | 18.22 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S3K1D4 | 856-1800 | 945 | IKEIALKVYQRKGDENVPLMKLMVKRIGTEVKLRSFDMMVNAYLGAVYVQHLQLKVSDAVLNRVPSQEHHDETEELALEQGPLIN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W2N1-F1 | 992-1942 | 99.78 | 68.16 | View in AlphaFoldDB ↗ |