DPCfam | MC473265
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 150 ± 20 aa |
| Residues in low-complexity regions (%) | 1.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.06 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05050 |
| Sequences matching dominant architecture (%) | 83.78 |
| Average overlap percent | 21.86 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009E3B0B9 | 97-233 | 137 | ERCDKPSSIIEASVIDFAACLNRYGIPHYLKIDIEGMDVLCLKALLSFSEKPNYISLESNKVDFEALKREFDLLCKLGYNSFQVI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q49942-F1 | 108-299 | 99.32 | 85.84 | View in AlphaFoldDB ↗ |