DPCfam | MC473189
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 120 ± 19 aa |
| Residues in low-complexity regions (%) | 12.66 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 63.79 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01424 |
| Sequences matching dominant architecture (%) | 44.44 |
| Average overlap percent | 11.58 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S4RRU5 | 1-113 | 113 | QRRPQNQGATRKRTKSNAKMKLVRSLAVCDDPSPPPAADAGVQDNQEPHSGGREEESVLRDKDRGSERATAERQEKMPKVPRILS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0JNC2-F1 | 55-167 | 100.00 | 49.73 | View in AlphaFoldDB ↗ |