DPCfam | MC472942
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 159 ± 22 aa |
| Residues in low-complexity regions (%) | 1.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.69 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F9XQS8 | 15-164 | 149 | LDRVFTATLENDSALVFWTGISPDLAKTWAGKNNLKTLTMAMGALYSDQSAASLRSRKTTKSWSSFMKGASGLFAQHACHGRRAI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NLG0-F1 | 11-173 | 94.74 | 87.67 | View in AlphaFoldDB ↗ |