DPCfam | MC472752
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 252 ± 38 aa |
| Residues in low-complexity regions (%) | 7.51 |
| Residues in coiled-coil regions (%) | 0.63 |
| Predicted disordered residues (%) | 22.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1C4W3V1 | 38-219 | 182 | AAVLAGLTDLEDLRLTFGEPPGVLTDLPELGRHQRLHSLQLDDAYGLDPENLPELPSLRHLTLNGTRRATATAVKARLKGGAVTV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5F643-F1 | 169-433 | 93.88 | 92.68 | View in AlphaFoldDB ↗ |