DPCfam | MC472426
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 56 ± 6 aa |
| Residues in low-complexity regions (%) | 0.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.99 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08718 |
| Sequences matching dominant architecture (%) | 96.15 |
| Average overlap percent | 25.27 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H3EIR5 | 1-57 | 57 | MTCAAPANNHTDFAKKEHLFPCLQEDSGIPTEPFLSAFQGLADFVGFMGTAFAPVKE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D8PPA5-F1 | 3-58 | 100.00 | 96.67 | View in AlphaFoldDB ↗ |