DPCfam | MC472241
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 80 ± 8 aa |
| Residues in low-complexity regions (%) | 2.77 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.34 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF08237 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 36.02 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0E4H0B4 | 223-297 | 75 | LADPNNPMGGVLTHWIPGFGTFNWPTPLTTSYATSIFTLQYDAIADFPVHPLWLPSDINALFGYLNLHATMPYLP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-L7N697-F1 | 231-305 | 97.40 | 85.47 | View in AlphaFoldDB ↗ |