DPCfam | MC471102
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 351 ± 28 aa |
| Residues in low-complexity regions (%) | 3.46 |
| Residues in coiled-coil regions (%) | 24.71 |
| Predicted disordered residues (%) | 21.59 |
| Average transmembrane regions | 0.41 |
| Dominant Pfam architecture(s) | PF05791 |
| Sequences matching dominant architecture (%) | 17.56 |
| Average overlap percent | 41.82 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00057075CD | 28-391 | 364 | FGNPDVFSSESDDFLLSEEEWIKLNMLARSASILPVTQESMRKRFNMSNNVAFDDVYQGMLTNYQNINQISSQWLGESGYRDRII... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q45758-F1 | 39-393 | 98.58 | 94.75 | View in AlphaFoldDB ↗ |