DPCfam | MC470815
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 59 ± 14 aa |
| Residues in low-complexity regions (%) | 4.18 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.44 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00307 |
| Sequences matching dominant architecture (%) | 54.74 |
| Average overlap percent | 36.05 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I8HW62 | 1171-1230 | 60 | LVLQNADLIEAREFLQPEDIVSGNSNLNVMFVANLFKRWPCLPELPDGGQAGAEQAAEKP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1M675-F1 | 346-417 | 97.06 | 86.79 | View in AlphaFoldDB ↗ |