DPCfam | MC46979
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 457 ± 65 aa |
| Residues in low-complexity regions (%) | 5.62 |
| Residues in coiled-coil regions (%) | 1.48 |
| Predicted disordered residues (%) | 22.04 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G2FT68 | 5-387 | 383 | IEEIWQSGRTLRELADRGHVHVSRVPIVANHLNVVLPCLSKSLRDIANYYDDKTVTRELRWRKMYHEMKKEADMELLQRFRLYNG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WDC0-F1 | 19-460 | 99.57 | 91.57 | View in AlphaFoldDB ↗ |