DPCfam | MC469723
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 77 ± 14 aa |
| Residues in low-complexity regions (%) | 2.32 |
| Residues in coiled-coil regions (%) | 0.09 |
| Predicted disordered residues (%) | 28.69 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13489 |
| Sequences matching dominant architecture (%) | 19.92 |
| Average overlap percent | 3.08 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B6M288 | 8-96 | 89 | SFGGRFLEEPSSVFQHNAWDNVQWDAEQEEAARRKVEQQGEKKIPDETKKLLTKETDQKWDEFYNIHQNRFFKDRHWLFTEFPEL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0P5B2-F1 | 21-105 | 98.84 | 91.68 | View in AlphaFoldDB ↗ |