DPCfam | MC469557
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Residues in low-complexity regions (%) | 8.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.59 |
| Average transmembrane regions | 2.03 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q7N7M8 | 23-122 | 100 | KRHFRRGLIVTLMMGGMLLVAAVGLAYPSQFNALQHWMYTTRYGWLAWRLAMYSVIACFMWQLWRSPLPLTQKAALKRIALISLG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GYD9-F1 | 19-110 | 96.91 | 71.34 | View in AlphaFoldDB ↗ |