DPCfam | MC46932
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 511 |
|---|---|
| Mean domain length (aa) | 107 ± 17 aa |
| Residues in low-complexity regions (%) | 5.23 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.98 |
| Average transmembrane regions | 0.8 |
| Dominant Pfam architecture(s) | PF01010 |
| Sequences matching dominant architecture (%) | 10.02 |
| Average overlap percent | 24.55 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F4KW41 | 523-630 | 108 | IGLAYSLYVQRNTVPVADEQEEGFGRVLNRKYFVDELYSTLFVKPAQTLSEWFGRIVDPKILDGAINGIGQSILSLGSVLKNIQQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P29924-F1 | 589-696 | 100.00 | 90.31 | View in AlphaFoldDB ↗ |