DPCfam | MC469217
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 351 |
|---|---|
| Mean domain length (aa) | 65 ± 6 aa |
| Residues in low-complexity regions (%) | 2.29 |
| Residues in coiled-coil regions (%) | 0.08 |
| Predicted disordered residues (%) | 10.28 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02682 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 32.84 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000B3A0A24 | 5-67 | 63 | PAGDRAMIVEFGSEIDDALNNQVHVLAKKLEESQIRGVLETVPTFRSLLIYYEPGEIKFGQLQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P60495-F1 | 6-65 | 89.55 | 92.54 | View in AlphaFoldDB ↗ |