DPCfam | MC468036
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 160 ± 22 aa |
| Residues in low-complexity regions (%) | 4.7 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.83 |
| Average transmembrane regions | 0.09 |
| Dominant Pfam architecture(s) | PF11066 |
| Sequences matching dominant architecture (%) | 1.57 |
| Average overlap percent | 87.87 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B7XL30 | 4-169 | 166 | LNAILPEYDAVEYHEIVINKSQNAVFEAIKNVDFGSSKIIVTLFRLRGIPTSKLSLQGLVESGMFSQLAEDALDETVLGMMVTNK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HTN6-F1 | 11-180 | 98.84 | 84.88 | View in AlphaFoldDB ↗ |