DPCfam | MC468022
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 110 ± 15 aa |
| Residues in low-complexity regions (%) | 0.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.56 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E3NIV1 | 592-708 | 117 | VEFDKPCAYFLGFTDNIVRGSGKAQKNVDFYGNVSALYLYCDCVEPNFIGNELAPLLSIIPCSGKYGDMIRHTITHPRYYPIMSS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O18244-F1 | 536-649 | 99.13 | 92.52 | View in AlphaFoldDB ↗ |