DPCfam | MC467903
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 110 ± 8 aa |
| Residues in low-complexity regions (%) | 1.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.11 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00989 |
| Sequences matching dominant architecture (%) | 42.55 |
| Average overlap percent | 77.18 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A059KHG0 | 12-121 | 110 | IPSVDRGAADAQPYGVVQVDDQGVIKLYNKWESEMAGVPISTAEGSNFFTQVAACTNNRLVFGKFKDGVARNDLDTEFNYTFTYK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P16113-F1 | 13-123 | 99.11 | 96.89 | View in AlphaFoldDB ↗ |