DPCfam | MC46721
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 94 ± 13 aa |
| Residues in low-complexity regions (%) | 1.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 51.5 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F3FGM1 | 857-925 | 69 | GWSVEGWNYNKDREQIVRGTVGAGDVVVRSDTGSKDSAAGLNRDVDKAYEITRDDEHRTDVYVTKSSVE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3B0B8-F1 | 510-545 | 38.54 | 96.29 | View in AlphaFoldDB ↗ |