DPCfam | MC467061
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 336 ± 59 aa |
| Residues in low-complexity regions (%) | 2.99 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 18.65 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF17408- PF05292 |
| Sequences matching dominant architecture (%) | 62.73 |
| Average overlap percent | 90.78 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0E0ERW4 | 139-393 | 255 | MYRMERGLREALRPKYAGFLEAMNAQPGGLKLLAVIRADLLALLGEENLPALRALDGYLKEKLVTWLSPAALTLHHITWDDPASL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A3KP65-F1 | 145-490 | 99.70 | 92.14 | View in AlphaFoldDB ↗ |