DPCfam | MC466668
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 501 |
|---|---|
| Mean domain length (aa) | 235 ± 58 aa |
| Residues in low-complexity regions (%) | 3.76 |
| Residues in coiled-coil regions (%) | 0.08 |
| Predicted disordered residues (%) | 19.06 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF04424 |
| Sequences matching dominant architecture (%) | 98.86 |
| Average overlap percent | 52.41 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D9XK98 | 326-535 | 210 | HLTKLVRFMGHNRRIVLQDANGPCSLLSICNCLILMGRINLGKQSRVSEYFLANQVFDLLFEKLKEDEIHPVLNVIKQSATALDV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1RBY0-F1 | 238-478 | 99.59 | 90.95 | View in AlphaFoldDB ↗ |