DPCfam | MC46665
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Residues in low-complexity regions (%) | 1.83 |
| Residues in coiled-coil regions (%) | 42.92 |
| Predicted disordered residues (%) | 31.3 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13949 |
| Sequences matching dominant architecture (%) | 98.39 |
| Average overlap percent | 34.29 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0008FA1D46 | 10-86 | 77 | QRISLESQLRDLIHKDDITGVLVTTDRAEIKTLFAEQLKKYDQLKGYIEQNLVAQDNILKALTEANVQYAPVRKTLT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8QCR7-F1 | 570-651 | 96.47 | 91.36 | View in AlphaFoldDB ↗ |