DPCfam | MC466502
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 441 |
|---|---|
| Mean domain length (aa) | 149 ± 23 aa |
| Residues in low-complexity regions (%) | 7.49 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 40.29 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF01514 |
| Sequences matching dominant architecture (%) | 1.09 |
| Average overlap percent | 38.99 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I1E288 | 23-179 | 157 | VVLGAAGILMIMLSELVPDSKVKTEKAKADSQICSADSGDFRNRTESELKELLEQIEGVGECEVMISLESSTEYIYAENISRFTE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P49784-F1 | 40-223 | 99.38 | 82.53 | View in AlphaFoldDB ↗ |