DPCfam | MC466207
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Residues in low-complexity regions (%) | 26.73 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 55.22 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00307 |
| Sequences matching dominant architecture (%) | 94.29 |
| Average overlap percent | 10.45 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0R1E936 | 2481-2558 | 78 | GSAASKNISPLAKFKQLDKQAAAQQAQKSSPTTSTPTTPGGSAQPLFKFTDPALNARAATVKDQLLQWCKHKTQEYEN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0G2K6Q4-F1 | 70-115 | 61.04 | 67.70 | View in AlphaFoldDB ↗ |