DPCfam | MC4660
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Residues in low-complexity regions (%) | 0.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.88 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G5HQI7 | 8-69 | 62 | RYLVLEQEDCENYLSETEQNILWEIQKKVLVSRHINGKSMKENYLVINRGDKKIQEIEKLLN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GZU4-F1 | 5-68 | 89.04 | 91.88 | View in AlphaFoldDB ↗ |