DPCfam | MC465785
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 63 ± 6 aa |
| Residues in low-complexity regions (%) | 3.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.09 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009DCEA8B | 8-70 | 63 | RFGVDVHLTVFLQGFRLDYRAHPTAAEHFLQEWTGYHGTHTAAVLRENPADLPRLPCERLYLD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EGK5-F1 | 14-73 | 95.31 | 96.17 | View in AlphaFoldDB ↗ |