DPCfam | MC465581
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 149 ± 25 aa |
| Residues in low-complexity regions (%) | 4.83 |
| Residues in coiled-coil regions (%) | 14.2 |
| Predicted disordered residues (%) | 56.99 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E5R131 | 224-411 | 188 | SSHRSGPASQTFPPPSFETRPSHSTWNFGASDHTSMDSVKSMQRSNGLPYCDAVKRHLDDYDVRASLNEVRDTSSRTLDILRPYS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NPX4-F1 | 314-482 | 97.01 | 73.69 | View in AlphaFoldDB ↗ |