DPCfam | MC465308
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 79 ± 10 aa |
| Residues in low-complexity regions (%) | 1.3 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.46 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05089 |
| Sequences matching dominant architecture (%) | 98.82 |
| Average overlap percent | 26.28 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T0Q971 | 271-354 | 84 | WAGFDRNYTCVYMLDPTDLLYRAVGKAFLTTQQALYGSYTSSLYSADTYNELVPHTSDHAYLRASSSAVIESMLAADPNAIWLM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9FNA3-F1 | 295-378 | 98.78 | 92.88 | View in AlphaFoldDB ↗ |