DPCfam | MC465240
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 99 ± 6 aa |
| Residues in low-complexity regions (%) | 0.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.59 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06874 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 19.7 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00076964D5 | 116-217 | 102 | LYLPCNGNLLIHGCIPVDENGEMESFEIDGQTYSGQELLDVFEYHVRKSFDEKENTDDLSTDLVWYLWTGKYSSLFGKRAMTTFE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q897W7-F1 | 413-516 | 100.00 | 95.48 | View in AlphaFoldDB ↗ |