DPCfam | MC46516
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 484 ± 72 aa |
| Residues in low-complexity regions (%) | 3.55 |
| Residues in coiled-coil regions (%) | 0.06 |
| Predicted disordered residues (%) | 19.76 |
| Average transmembrane regions | 0.68 |
| Dominant Pfam architecture(s) | PF18566 |
| Sequences matching dominant architecture (%) | 84.44 |
| Average overlap percent | 61.88 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B9K513 | 17-482 | 466 | RMPMLDADQIGHLRRIENLSLLLPDDWSGMQAKSTLQEDFGGLRFQLAYMSYALALTHRHRLPAAPGVFRKTFERLIEKILSPDV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2GYG3-F1 | 16-542 | 96.44 | 89.67 | View in AlphaFoldDB ↗ |