DPCfam | MC464826
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 641 |
|---|---|
| Mean domain length (aa) | 402 ± 66 aa |
| Residues in low-complexity regions (%) | 1.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.62 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF06253 |
| Sequences matching dominant architecture (%) | 98.36 |
| Average overlap percent | 92.48 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I1U155 | 94-527 | 434 | LKVLSQTDILKIHNAALQVLEEIGLADAPQSGIDHMTRAGAIHGTDGRMRFPRALVEDTVAHANRQIMLYSRDGKRDLELSGNRV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q24SP7-F1 | 10-441 | 99.77 | 98.47 | View in AlphaFoldDB ↗ |