DPCfam | MC464813
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 85 ± 7 aa |
| Residues in low-complexity regions (%) | 1.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.93 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14684 |
| Sequences matching dominant architecture (%) | 99.05 |
| Average overlap percent | 17.44 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F3D7C6 | 345-433 | 89 | MKFSLTDEKNEEILDNVMTASLSADRKMVIYRSGGDYGIIKITPGQKAGAGKLGLNGLEMKIDPHKEWDQIYVDAWRIFRDYFYV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q972G5-F1 | 410-499 | 98.84 | 95.02 | View in AlphaFoldDB ↗ |