DPCfam | MC464501
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 202 ± 11 aa |
| Residues in low-complexity regions (%) | 4.28 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.24 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01270 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 52.8 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0004887935 | 234-446 | 212 | DKNTWRLNPSYVPLQLMRRFALALQAAPEAPEWKAMLDSSTQLVNGTAPHGYSPDWVEYRAQNGGKGAFAPDAQTHAESAYNAIR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P58935-F1 | 177-376 | 100.00 | 96.85 | View in AlphaFoldDB ↗ |