DPCfam | MC46439
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 66 ± 5 aa |
| Residues in low-complexity regions (%) | 0.83 |
| Residues in coiled-coil regions (%) | 52.9 |
| Predicted disordered residues (%) | 24.52 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00037D6B74 | 129-193 | 65 | LAAQCKETQLDMLSSLGEAEKYKSLMVELPQIADALEAEYLDARHRSSRLLGQLRALEKTLQTLQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9KVG9-F1 | 101-165 | 97.01 | 96.38 | View in AlphaFoldDB ↗ |