DPCfam | MC463320
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 128 ± 17 aa |
| Residues in low-complexity regions (%) | 10.55 |
| Residues in coiled-coil regions (%) | 0.11 |
| Predicted disordered residues (%) | 12.78 |
| Average transmembrane regions | 1.75 |
| Dominant Pfam architecture(s) | PF16212 |
| Sequences matching dominant architecture (%) | 92.86 |
| Average overlap percent | 26.78 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I7S4R2 | 1308-1442 | 135 | SLGFYFLVVVLYYQVIPYSFISYGPTGNFYGVVWQAVVTPHFWFSLLLICVLLLLPVFLNRFFWLDTKPSYADRLRARSKLPLHE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P98198-F1 | 1028-1167 | 99.31 | 75.61 | View in AlphaFoldDB ↗ |