DPCfam | MC46311
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 257 ± 30 aa |
| Residues in low-complexity regions (%) | 1.98 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.1 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16218 |
| Sequences matching dominant architecture (%) | 89.29 |
| Average overlap percent | 94.87 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F6S3V8 | 19-290 | 272 | IHPSISDHKLGVGPEMDIVEYCKKEWRGKTTVAQIMKKGYEQVSHSFGSIRRVRGDNYCALRATLFQALSQTAKLPEWLDDSELN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q3UCV8-F1 | 81-343 | 99.63 | 95.03 | View in AlphaFoldDB ↗ |