DPCfam | MC463050
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 175 ± 32 aa |
| Residues in low-complexity regions (%) | 11.53 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 56.78 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06881 |
| Sequences matching dominant architecture (%) | 6.82 |
| Average overlap percent | 35.3 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000947BB16 | 277-552 | 276 | EGKGHSQVAGERPRVSKPVTKEISQPKEVTKETRADRKSKVSFDEPKEDGLGSGDEDFDEPTQSFEDYLNYDLPVKVKKKKVKKP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q63187-F1 | 387-564 | 97.80 | 56.22 | View in AlphaFoldDB ↗ |