DPCfam | MC463012
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 116 ± 14 aa |
| Residues in low-complexity regions (%) | 1.33 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.55 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05621 |
| Sequences matching dominant architecture (%) | 99.35 |
| Average overlap percent | 56.0 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D6TJC9 | 3-133 | 131 | HLSEKTRKFVEIATDEQRIKHIKEFRWIGYSDAIKILKKMDDLLDYPKSSRMPNLLLVGDSNNGKTVLLNQFHKRHQAYVEEDEN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-G3UYQ4-F1 | 1384-1418 | 27.97 | 84.19 | View in AlphaFoldDB ↗ |