DPCfam | MC462965
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 281 |
|---|---|
| Mean domain length (aa) | 134 ± 14 aa |
| Residues in low-complexity regions (%) | 1.26 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.4 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00133 |
| Sequences matching dominant architecture (%) | 70.0 |
| Average overlap percent | 23.75 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K2S5X4 | 592-723 | 132 | KGMQTYYPEAQHAFKMTLGWLSQWACSRSYGLGTKLPWDATQLVESLSDSTIYMSYYTIAHYLHGDIFGKTAGLAKQRITPEQMT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VQR8-F1 | 531-679 | 100.00 | 93.96 | View in AlphaFoldDB ↗ |