DPCfam | MC462949
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 67 ± 9 aa |
| Residues in low-complexity regions (%) | 13.97 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.2 |
| Average transmembrane regions | 0.94 |
| Dominant Pfam architecture(s) | PF08592 |
| Sequences matching dominant architecture (%) | 91.21 |
| Average overlap percent | 56.6 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W1VV10 | 96-163 | 68 | LTVAMAVTLLLVSVVMSIMLLVPIASRAARWSAESAPGDWQAQVSRWNGFHYVRVGIITAAFVLLVLA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0ESP3-F1 | 83-148 | 95.65 | 97.52 | View in AlphaFoldDB ↗ |