DPCfam | MC462799
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 2401 |
|---|---|
| Mean domain length (aa) | 338 ± 50 aa |
| Residues in low-complexity regions (%) | 3.16 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.74 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF02784- PF00278 |
| Sequences matching dominant architecture (%) | 58.0 |
| Average overlap percent | 93.1 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A067EB44 | 25-235 | 211 | AEALGSNFDYASQAEIKGKWHPRCDLLIRIKALDDCKAVCPQAQDSKCGANLAEIGALLEAALASQLGVVGISFHIGSGATDFGA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P27118-F1 | 30-388 | 99.66 | 94.49 | View in AlphaFoldDB ↗ |