DPCfam | MC462779
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 431 |
|---|---|
| Mean domain length (aa) | 72 ± 7 aa |
| Residues in low-complexity regions (%) | 7.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.99 |
| Average transmembrane regions | 1.09 |
| Dominant Pfam architecture(s) | PF01312 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 21.93 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A151QFM3 | 83-153 | 71 | SALLFMGFAAAGMLIGMFSTWAHIGFVVSTEPVLPSIKKLNFVENIKNMFSKKSLLLLVTAFFKITFVFLG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P35538-F1 | 97-168 | 96.00 | 87.75 | View in AlphaFoldDB ↗ |