DPCfam | MC46267
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 147 ± 14 aa |
| Residues in low-complexity regions (%) | 1.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.87 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06938 |
| Sequences matching dominant architecture (%) | 91.23 |
| Average overlap percent | 88.18 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A9F8X3 | 16-150 | 135 | PGTSRESSIRLDREGRFWHDGARVDHPAIERGLRSWIGRHPDDGRPILTNGYDWCYFQVDDAPLFVDALRIGEGGAVSLLLFDGT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HZP4-F1 | 24-176 | 100.00 | 96.45 | View in AlphaFoldDB ↗ |