DPCfam | MC462660
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 80 ± 7 aa |
| Residues in low-complexity regions (%) | 0.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.17 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01593 |
| Sequences matching dominant architecture (%) | 6.17 |
| Average overlap percent | 15.2 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000529B341 | 214-286 | 73 | GMGSFLVFAGLRGSAAELALPATNFWIYPHNDLDTMMTHYSALSRDDVPENLAMMFITFPAAKDPTYEQRHPG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q64FG0-F1 | 376-456 | 98.80 | 96.63 | View in AlphaFoldDB ↗ |