DPCfam | MC462650
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 761 |
|---|---|
| Mean domain length (aa) | 135 ± 12 aa |
| Residues in low-complexity regions (%) | 2.45 |
| Residues in coiled-coil regions (%) | 0.08 |
| Predicted disordered residues (%) | 30.97 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04404 |
| Sequences matching dominant architecture (%) | 98.95 |
| Average overlap percent | 90.23 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000689C211 | 14-148 | 135 | LAKAWGELETPKHNATVKVTMKSGGSYTFDYTDLNGIFEAARKVFKVNEISIIQNSYTELTEHGSLACVETMFLHSSGEWVKSLP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077ZI46-F1 | 262-403 | 93.70 | 65.21 | View in AlphaFoldDB ↗ |