DPCfam | MC462601
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 99 ± 11 aa |
| Residues in low-complexity regions (%) | 4.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.91 |
| Average transmembrane regions | 0.18 |
| Dominant Pfam architecture(s) | PF14228 |
| Sequences matching dominant architecture (%) | 66.96 |
| Average overlap percent | 56.13 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K7IAS6 | 320-422 | 103 | LPMPAYGGHYSPLSQFLPPVVQPVQFFNKSEVGLLLVCDIIRTRSTVDWSDSLALLLHFSILRLDSLRPALCRHARQAIINVLMI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077Z060-F1 | 807-895 | 86.41 | 79.51 | View in AlphaFoldDB ↗ |