DPCfam | MC46256
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 1008 ± 147 aa |
| Residues in low-complexity regions (%) | 6.65 |
| Residues in coiled-coil regions (%) | 18.58 |
| Predicted disordered residues (%) | 26.12 |
| Average transmembrane regions | 0.08 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A2A61CC | 123-955 | 833 | SFSDEIFNNSSPGNETSEDDTLPEPQQMSSFQRNVLWKFEDLHMLVGTNVPIFGGGKYPAVSLRLRDCGKPINVLTGLDYWLDNL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VSP0-F1 | 36-1147 | 99.81 | 78.69 | View in AlphaFoldDB ↗ |