DPCfam | MC46249
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 131 ± 26 aa |
| Residues in low-complexity regions (%) | 2.36 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.8 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF06314 |
| Sequences matching dominant architecture (%) | 54.62 |
| Average overlap percent | 67.9 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0Q6FHH8 | 12-124 | 113 | SYPPSPWRLHGQLWLSLFRVRRGADPLHPDRPAGLHGVALVSYEDPSPLVYRELLCARPRGADVGITDIWVDSPASRAGGRDLWA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GNS6-F1 | 24-164 | 89.17 | 95.67 | View in AlphaFoldDB ↗ |