DPCfam | MC462440
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 61 ± 7 aa |
| Residues in low-complexity regions (%) | 0.5 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 46.72 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF02178 |
| Sequences matching dominant architecture (%) | 2.9 |
| Average overlap percent | 2.65 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00076FC8F2 | 191-247 | 57 | EQQNFLGCLGLITADKHKELQNKRAERKRRSTANPQFVYSNWEIPTKRKRHSYLQSN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q96EK2-F1 | 275-333 | 98.36 | 69.39 | View in AlphaFoldDB ↗ |