DPCfam | MC46239
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 118 ± 10 aa |
| Residues in low-complexity regions (%) | 4.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.74 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17831 |
| Sequences matching dominant architecture (%) | 76.27 |
| Average overlap percent | 19.48 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E7V714 | 155-285 | 131 | NCMPFDPATGEEVRAILRSALATLYLEQQPGYYYLAIHDEDADEDADVVAPLSAADAAAASLGMYRVSPPGPAPCRVRLCGAGRM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q59637-F1 | 648-768 | 100.00 | 98.02 | View in AlphaFoldDB ↗ |