DPCfam | MC462340
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 154 ± 23 aa |
| Residues in low-complexity regions (%) | 3.51 |
| Residues in coiled-coil regions (%) | 0.36 |
| Predicted disordered residues (%) | 31.33 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16930 |
| Sequences matching dominant architecture (%) | 94.52 |
| Average overlap percent | 44.94 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D6BIE3 | 126-335 | 210 | DWVSRISFDGDIRLREESRFFADNNSNEIVDYAKLNDNGPYDVNKDTNSKLPPLLNSREDRDNLFRLRARLGMKAVISPEWTAGI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I5N0-F1 | 113-279 | 97.22 | 92.75 | View in AlphaFoldDB ↗ |